PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6KG269800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 169aa    MW: 19371.3 Da    PI: 10.2895
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6KG269800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.62.9e-27959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         kri+n + rqvtfskRr g++KKA+EL +LCdaev +i+fsstg+ly+++s
  Pavir.6KG269800.2.p  9 KRIDNATSRQVTFSKRRSGLFKKAKELAILCDAEVGLIVFSSTGRLYDFAS 59
                         79***********************************************86 PP

2K-box73.75.1e-2578159687
                K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekel 87 
                          ++  ++a+a+ +q+e+  L+++++nLq+ +R+llG++L  L++k+Lq+Le++Le sl++iR kK++l+++qi+el +k  ++
  Pavir.6KG269800.2.p  78 QTMSASAEAKLWQREAGSLRQQLHNLQEHHRQLLGQKLCGLDVKDLQNLENKLEMSLRNIRMKKDQLMIDQIQELNRKVCSH 159
                          3336788899*******************************************************************97655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.4E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
CDDcd002656.09E-45278No hitNo description
SuperFamilySSF554555.36E-33291IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.3E-2383156IPR002487Transcription factor, K-box
PROSITE profilePS5129712.92386168IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MGRGKIEIKR IDNATSRQVT FSKRRSGLFK KAKELAILCD AEVGLIVFSS TGRLYDFAST  60
SMKSVIERYS EAKDDHHQTM SASAEAKLWQ REAGSLRQQL HNLQEHHRQL LGQKLCGLDV  120
KDLQNLENKL EMSLRNIRMK KDQLMIDQIQ ELNRKVCSHN SIKITNQF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S8e-23176176Myocyte-specific enhancer factor 2B
1tqe_R8e-23176176Myocyte-specific enhancer factor 2B
1tqe_Q8e-23176176Myocyte-specific enhancer factor 2B
1tqe_P8e-23176176Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973502.11e-105PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6VAM45e-97MAD23_ORYSJ; MADS-box transcription factor 23
TrEMBLA0A0D3H0I71e-94A0A0D3H0I7_9ORYZ; Uncharacterized protein
TrEMBLI1QIW93e-95I1QIW9_ORYGL; Uncharacterized protein
STRINGORGLA08G0137000.18e-95(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.14e-78AGAMOUS-like 16